Posts tagged "bride"
  1. Notes: 17 / 4 months ago  from wiscoman-deactivated20120222
    She’s waiting for her husband to finish fucking the bridesmaids.

    She’s waiting for her husband to finish fucking the bridesmaids.

     
  2. Notes: 5 / 7 months ago 
    “one last round and then she should be ready to fit her new husband in all her holes”

    “one last round and then she should be ready to fit her new husband in all her holes”

     
  3. Notes: 1 / 7 months ago 
     
  4. Notes: 5 / 7 months ago 
     
  5. 7 months ago  from bookmarklet
    Bride having her picture taken with the bridesmaids. Nothing wrong with that?

    Bride having her picture taken with the bridesmaids. Nothing wrong with that?

     
  6. Notes: 84 / 9 months ago  from nymphomaniac-fantasia (originally from art-or-porn)
    I don’t know, it does work well in focussing your attention on her face. I would make her get rid of the panties though nymphomaniac-fantasia: Whilst my dream wedding outfit clearly consists of nothing but a while collar + leash and a veil to hide my blushing face, this is not a bad option for that shy, pouty slave fiancée who insists on wearing clothes. However, not making the effort of finding a white collar just comes off as lazy to me. 

    I don’t know, it does work well in focussing your attention on her face. I would make her get rid of the panties though

    nymphomaniac-fantasia:

    Whilst my dream wedding outfit clearly consists of nothing but a while collar + leash and a veil to hide my blushing face, this is not a bad option for that shy, pouty slave fiancée who insists on wearing clothes. However, not making the effort of finding a white collar just comes off as lazy to me. 

     
  7. Notes: 420 / 10 months ago  from fetish4 (originally from lordschuft)
    Lovely light!

    Lovely light!

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornolabialoungekousokufuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr