Posts tagged "corset"
  1. 2 days ago  from bookmarklet
     
  2. Notes: 68 / 3 days ago  from bndgelvr (originally from girlsinrubber)
    Love the outfit girlsinrubber: Dannii Harwood kinky bondage babe in the dungeon

    Love the outfit

    girlsinrubber:

    Dannii Harwood kinky bondage babe in the dungeon

     
  3. 1 week ago 
    Not doing much work if you tie her to the chair lordeestevao: (via secretarialstudies) Pausa para o descanso. (via lordeestevao)

    Not doing much work if you tie her to the chair

    lordeestevao:

    (via secretarialstudies)

    Pausa para o descanso.

    (via lordeestevao)

     
  4. Notes: 79 / 1 week ago  from everydaycollars (originally from beautifulfetish)
    A corset and a harness, that’s going to be tight beautifulfetish: More of Laurie Wallace.  Click the image for the photoset

    A corset and a harness, that’s going to be tight

    beautifulfetish:

    More of Laurie Wallace.  Click the image for the photoset

     
  5. Notes: 112 / 4 weeks ago  from chilx (originally from bondagelover)

    (Source: bondagelover)

     
  6. Notes: 4 / 4 weeks ago  from bookmarklet
    Smile!

    Smile!

     
  7. Notes: 2 / 1 month ago  from bookmarklet
    Heels, stockings, gloves and a corset, always a good combination.

    Heels, stockings, gloves and a corset, always a good combination.

     
  8. Notes: 13 / 1 month ago  from bookmarklet
    Yes, 20 more and in front of the window where everyone can see!

    Yes, 20 more and in front of the window where everyone can see!

     
  9. 1 month ago  from bookmarklet
     
  10. Notes: 160 / 1 month ago  from giggity-gig (originally from trussed)
    So pretty! giggity-gig: Giggity gig!

    So pretty!

    giggity-gig:

    Giggity gig!

    (Source: trussed)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornokousokufuckyeahstockingslabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr