Posts tagged "drooling"
  1. Notes: 46 / 4 months ago  from puppygirlsnplaythings (originally from 2krazy)
    puppyslutmaria: “You’re going to be my fuckmutt - my drooling, panting, barking bitch,” he said quietly. “This has just been the first day. How long do you really think you can fight? Of course, I have freedom right here in this syringe. Let me wipe away that pesky thinking and talking and trying to pretend you’re more than a dumb doggy whore who lives to please me. One shot and all the pain will dissolve along with your mind.” He raised the syringe expectantly; she thought about how no one had seen her taken from the airport, and the fact that she had no idea where she was right now. She thought about the other girls, dull-eyed but panting happily as they barked and chewed on rubber toys and competed for His favor. She thought about how unlikely it was she could hold out for even another day, let alone until rescue came. Tears in her eyes, she nodded.

    puppyslutmaria:

    “You’re going to be my fuckmutt - my drooling, panting, barking bitch,” he said quietly. “This has just been the first day. How long do you really think you can fight? Of course, I have freedom right here in this syringe. Let me wipe away that pesky thinking and talking and trying to pretend you’re more than a dumb doggy whore who lives to please me. One shot and all the pain will dissolve along with your mind.”

    He raised the syringe expectantly; she thought about how no one had seen her taken from the airport, and the fact that she had no idea where she was right now. She thought about the other girls, dull-eyed but panting happily as they barked and chewed on rubber toys and competed for His favor. She thought about how unlikely it was she could hold out for even another day, let alone until rescue came.

    Tears in her eyes, she nodded.

    (Source: 2krazy)

     
  2. Notes: 161 / 1 year ago  from alittlespicy (originally from art-or-porn)
    The whole point of drooling is an affirmation of the loss of control. cumdoll: It’s taken me quite some time to get over being a bit disgusted by drool.  I really like to be put together, put effort into myself and my appearance, so being messy is one of those things He’s had to drill into me (literally, hee!).  Because of that, I can honestly say that I find this photo very beautiful.

    The whole point of drooling is an affirmation of the loss of control.

    cumdoll:

    It’s taken me quite some time to get over being a bit disgusted by drool.  I really like to be put together, put effort into myself and my appearance, so being messy is one of those things He’s had to drill into me (literally, hee!).  Because of that, I can honestly say that I find this photo very beautiful.

     
  3. Notes: 3 / 1 year ago 
     
  4. 2 years ago 
    Once the drooling starts they can’t stop mywifetheslut: Some images just don’t need any comment.. Wonderful.

    Once the drooling starts they can’t stop

    mywifetheslut:

    Some images just don’t need any comment.. Wonderful.

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokudailypornolabialoungefuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr