Posts tagged "gloves"
  1. Notes: 70 / 1 week ago  from mywifetheslut (originally from jekathy-deactivated20120221)
    Satin gloves do feel nice on your cock though
mywifetheslut:

Not only taking a huge load of piss, she keeps a horny face while doing it. Kudo’s!!

    Satin gloves do feel nice on your cock though

    mywifetheslut:

    Not only taking a huge load of piss, she keeps a horny face while doing it. Kudo’s!!

     
  2. Notes: 2 / 1 month ago  from bookmarklet
    Heels, stockings, gloves and a corset, always a good combination.

    Heels, stockings, gloves and a corset, always a good combination.

     
  3. Notes: 22 / 1 month ago  from trussed
    Corset, stockings and gloves, always nice

    Corset, stockings and gloves, always nice

    (Source: trussed)

     
  4. Notes: 34 / 1 month ago  from trussed
    I don’t know about this one. Love the outfit but she has a lot of control over the positioning of that hitachi

    I don’t know about this one. Love the outfit but she has a lot of control over the positioning of that hitachi

    (Source: trussed)

     
  5. Notes: 4 / 1 month ago  from bookmarklet
     
  6. Notes: 39 / 2 months ago  from nylonfoxie
    nylonfoxie:

Holly Valance…nylonfoxie

    nylonfoxie:

    Holly Valance…nylonfoxie

     
  7. Notes: 372 / 2 months ago  from glamourbound

    That’s a mean tease

    lipstickandlatex:

    View more gifs by me! xoxoxo

    (Source: glamourbound)

  8. Notes: 68 / 2 months ago  from akinkygent (originally from scentofslave)
    Good outfit, now all you need is a crop
akinkygent:

She looks yummy in those ropes, love her breasts!

    Good outfit, now all you need is a crop

    akinkygent:

    She looks yummy in those ropes, love her breasts!

    (Source: scentofslave)

     
  9. Notes: 1690 / 2 months ago  from prettypornandotherloves (originally from fuckthegifs)
    Long gloves and deep throat.. yum!
lcove2000:

Damnnnnn girl …NSFW 18+
sexylawdog:

ohhhhh fuckkk!!!!

    Long gloves and deep throat.. yum!

    lcove2000:

    Damnnnnn girl …NSFW 18+

    sexylawdog:

    ohhhhh fuckkk!!!!

    (Source: fuckthegifs)

     
  10. Notes: 17 / 2 months ago  from mind-effing (originally from a-season-of-bondage-perfection)
    Pretty in a late 1990s style.

    Pretty in a late 1990s style.

    (Source: a-season-of-bondage-perfection)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterfuckyeahstockingslabialoungekousokudailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr