Posts tagged "heels"
  1. Notes: 163 / 2 weeks ago  from bookmarklet
    Cute or not, you are still going to get spanked for wearing panties

    Cute or not, you are still going to get spanked for wearing panties

     
  2. Notes: 2 / 1 month ago  from bookmarklet
    Heels, stockings, gloves and a corset, always a good combination.

    Heels, stockings, gloves and a corset, always a good combination.

     
  3. Notes: 281 / 1 month ago  from aryehpride (originally from workshoperotica)
    That’s what I like about petticoats

    That’s what I like about petticoats

     
  4. Notes: 21 / 3 months ago  from wiscoman-deactivated20120222
     
  5. Notes: 20 / 4 months ago  from bookmarklet
    Ready to fill her up!

    Ready to fill her up!

     
  6. Notes: 50 / 4 months ago  from wiscoman-deactivated20120222
    Such a nice position for a long, loooong fuck. wiscoman: And so ends our broadcast day. I’m going to head to bed in a bit. Stick around for the queue.

    Such a nice position for a long, loooong fuck.

    wiscoman:

    And so ends our broadcast day. I’m going to head to bed in a bit. Stick around for the queue.

     
  7. Notes: 16 / 4 months ago  from wiscoman-deactivated20120222
  8. Notes: 13 / 4 months ago  from wiscoman-deactivated20120222
    Hehehe, of course you can have the phone

    Hehehe, of course you can have the phone

     
  9. Notes: 23 / 4 months ago  from bondagedream (originally from fan2fap)
    How do you get a monster dildo up your ass? Practice!

    How do you get a monster dildo up your ass? Practice!

    (Source: fan2fap)

     
  10. Notes: 1632 / 5 months ago  from fetish4 (originally from filmnoire)
    High heels + bald pussy = nice

    High heels + bald pussy = nice

    (Source: filmnoire)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokufuckyeahstockingslabialoungedailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr