Posts tagged "hitachi"
  1. Notes: 1016 / 4 days ago  from toesnfeets (originally from allthissexispowerful)
    [Flash 10 is required to watch video]

    (Source: allthissexispowerful)

  2. Notes: 56 / 1 week ago  from mind-effing (originally from glamourbound)

    glamourbound:

    View more Glamour Bound gifs!

  3. Notes: 1 / 3 weeks ago  from bookmarklet
     
  4. Notes: 24 / 1 month ago  from bookmarklet
     
  5. Notes: 6 / 1 month ago  from bookmarklet
    The hitachi just found the spot, moaning is not far away.

    The hitachi just found the spot, moaning is not far away.

     
  6. Notes: 34 / 1 month ago  from trussed
    I don’t know about this one. Love the outfit but she has a lot of control over the positioning of that hitachi

    I don’t know about this one. Love the outfit but she has a lot of control over the positioning of that hitachi

    (Source: trussed)

     
  7. Notes: 13 / 2 months ago  from trussed
    How long can she keep that up

    How long can she keep that up

    (Source: trussed)

     
  8. Notes: 5 / 2 months ago  from bookmarklet
    Paulina James riding the hitachi. Click for the whole series

    Paulina James riding the hitachi. Click for the whole series

     
  9. Notes: 1373 / 2 months ago  from yesdaddy (originally from onlysexualgifs)
    Nice, wonder how many times you can make her cum like that “forced orgasm…knowing that the whole room was watching her only made her cum harder.”

    Nice, wonder how many times you can make her cum like that

    “forced orgasm…knowing that the whole room was watching her only made her cum harder.”

     
  10. Notes: 33 / 3 months ago  from thetamingoftheslut (originally from trussed)
    xspanked-masters-petx: Love the idea of playing with a red head next time… and look, she even knows your favorite game…

    xspanked-masters-petx:

    Love the idea of playing with a red head next time… and look, she even knows your favorite game…

    (Source: trussed)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokulabialoungefuckyeahstockingsdailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr