Posts tagged "latex"
  1. Notes: 28 / 1 month ago  from masterandslave
    masterandslave: Two toys put to good use. ~cockdoll

    masterandslave:

    Two toys put to good use.

    ~cockdoll

     
  2. 1 month ago  from bookmarklet
     
  3. Notes: 9 / 1 month ago  from babyurastar
    babyurastar: Mandy latex air hostess uniform by HOUSEofHARLOT model: by Calamity Amelie

    babyurastar:

    Mandy latex air hostess uniform by HOUSEofHARLOT

    model: by Calamity Amelie

     
  4. Notes: 4 / 1 month ago  from bookmarklet
     
  5. Notes: 2 / 1 month ago  from bookmarklet
     
  6. Notes: 84 / 3 months ago  from begginguntilicum (originally from glamourbound)

    (Source: glamourbound)

     
  7. Notes: 118 / 3 months ago  from planetearthfactory (originally from latex-lair)
    Pretty ponies

    Pretty ponies

    (Source: latex-lair)

     
  8. Notes: 17 / 3 months ago  from trussed
    makes me smile this one

    makes me smile this one

    (Source: trussed)

     
  9. Notes: 399 / 3 months ago  from shinyretrostingy (originally from fuckyeahbiancabeauchamp)
    Latex works well on redheads, wonder why that is.

    Latex works well on redheads, wonder why that is.

     
  10. Notes: 269 / 3 months ago  from shinyretrostingy (originally from officialrivimadison)
    Pretty!

    Pretty!

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungefuckyeahstockingsdailypornokousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr