Posts tagged "lesbian"
  1. Notes: 395 / 2 weeks ago  from visualfetish (originally from anythingme)
    assplugged: assplugged.tumblr.com

    assplugged:

    assplugged.tumblr.com

     
  2. Notes: 1 / 2 weeks ago  from bookmarklet
    Oh, come on, that can go in easily!

    Oh, come on, that can go in easily!

     
  3. Notes: 3 / 3 weeks ago  from bookmarklet
    Staff sergeant gives her private some extra training

    Staff sergeant gives her private some extra training

     
  4. 3 weeks ago  from bookmarklet
    Thar’ she blows!

    Thar’ she blows!

     
  5. Notes: 2 / 3 weeks ago  from bookmarklet
    See, told you she likes it rough

    See, told you she likes it rough

     
  6. Notes: 5 / 3 weeks ago  from bookmarklet
    I think the slut on the right likes it rough

    I think the slut on the right likes it rough

     
  7. 3 weeks ago  from bookmarklet
     
  8. Notes: 466 / 4 weeks ago  from diaryofasubfreak (originally from lezemgif)

    That’s some serious pounding action!

    (Source: lezemgif)

  9. Notes: 13 / 1 month ago  from bookmarklet
    Yes, 20 more and in front of the window where everyone can see!

    Yes, 20 more and in front of the window where everyone can see!

     
  10. Notes: 5 / 1 month ago  from bookmarklet
    Lube the fist before it goes into the other hole

    Lube the fist before it goes into the other hole

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornofuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr