Posts tagged "lingerie"
  1. Notes: 752 / 4 weeks ago  from chilx (originally from imagesofmydesire-deactivated201)
    My wife has a top just like that.

    My wife has a top just like that.

     
  2. 1 month ago 

    And you can’t see agent provocateur without mentioning this kylie commercial

  3. 1 month ago 

    And you can’t see agent provocateur without mentioning this kylie commercial

  4. Notes: 1 / 1 month ago  from bookmarklet
    Don’t stop when you’re caught mastrubating! (click on her to see a friend join her)

    Don’t stop when you’re caught mastrubating! (click on her to see a friend join her)

     
  5. Notes: 4 / 1 month ago 

    OK, one more agent provocateur commercial then..

  6. 1 month ago 

    And you can’t see agent provocateur without mentioning this kylie commercial

  7. Notes: 44 / 1 month ago  from lingerie-love

    Probably the lingerie brand with the best commercials

    lingerie-love:

    agentprovocateur.com

  8. Notes: 180 / 2 months ago  from painslutx (originally from lustfulkitty)
    Ready to have cum sprayed all over her.

    Ready to have cum sprayed all over her.

    (Source: lustfulkitty)

     
  9. Notes: 247 / 2 months ago  from garteredass (originally from gretchenkitty)
    sexylayla: love pink and black  #fishnets

    sexylayla:

    love pink and black  #fishnets

    (Source: gretchenkitty)

     
  10. Notes: 706 / 2 months ago  from fetish4 (originally from love-to-love-you)
    Yeah, spring’s nearly here

    Yeah, spring’s nearly here

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungekousokudailypornofuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr