Posts tagged "nipple clamps"
  1. Notes: 121 / 3 months ago  from mind-effing (originally from scentofslave)
    Bounce ‘m!

    Bounce ‘m!

    (Source: scentofslave)

     
  2. Notes: 14 / 3 months ago  from wiscoman-deactivated20120222
     
  3. Notes: 365 / 4 months ago  from spankopera (originally from sexcandie)
    spankopera: Berlin? Undoubtedly getting her station-ticket’s worth anyway. herpandora: Yummy…

    spankopera:

    Berlin? Undoubtedly getting her station-ticket’s worth anyway.

    herpandora: Yummy…

    (Source: sexcandie)

     
  4. Notes: 7 / 4 months ago  from bookmarklet
    Nipple clamps to ankles are always fun. That suction cup on her clit looks interesting

    Nipple clamps to ankles are always fun. That suction cup on her clit looks interesting

     
  5. Notes: 3 / 4 months ago  from bookmarklet
     
  6. Notes: 34 / 4 months ago  from bondagedream (originally from glamourbound)
    Something to cum over and leave tied for hours.

    Something to cum over and leave tied for hours.

    (Source: glamourbound)

     
  7. Notes: 47 / 5 months ago  from mind-effing (originally from redmagick666)
    What happened? Was she forced to put these on herself? Or is this simply sloppy bondage?

    What happened? Was she forced to put these on herself? Or is this simply sloppy bondage?

    (Source: redmagick666)

     
  8. Notes: 33 / 5 months ago  from wiscoman-deactivated20120222 (originally from autumnalmutterings)
    Hehehe autumnalmutterings: You were the one begging me for those nipple clamps as a Christmas gift, as I recall.

    Hehehe

    autumnalmutterings:

    You were the one begging me for those nipple clamps as a Christmas gift, as I recall.

     
  9. Notes: 2 / 5 months ago 
     
  10. Notes: 103 / 6 months ago  from ropebondage (originally from johnnyadidas)
    How often do you see wallpaper featuring so prominently in a shoot?

    How often do you see wallpaper featuring so prominently in a shoot?

    (Source: johnnyadidas)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungefuckyeahstockingsdailypornokousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr