Posts tagged "redhead"
  1. Notes: 5 / 3 months ago  from bookmarklet
    Fun with the sybian. Image links to the complete series.

    Fun with the sybian. Image links to the complete series.

     
  2. Notes: 19 / 3 months ago  from wiscoman-deactivated20120222
     
  3. Notes: 399 / 3 months ago  from shinyretrostingy (originally from fuckyeahbiancabeauchamp)
    Latex works well on redheads, wonder why that is.

    Latex works well on redheads, wonder why that is.

     
  4. Notes: 2 / 3 months ago  from bookmarklet
    A very young Julia Hayes posing for Suze Randall…

    A very young Julia Hayes posing for Suze Randall…

     
  5. Notes: 8 / 3 months ago  from bookmarklet
    Redhead, plaid skirt, sasha monet does this so well

    Redhead, plaid skirt, sasha monet does this so well

     
  6. 4 months ago  from bookmarklet
    Nice for wiggling!

    Nice for wiggling!

     
  7. 4 months ago  from bookmarklet
     
  8. Notes: 8 / 4 months ago  from bookmarklet
    That looks like a nice toy

    That looks like a nice toy

     
  9. Notes: 20 / 4 months ago  from bookmarklet
    Ready to fill her up!

    Ready to fill her up!

     
  10. Notes: 7 / 4 months ago  from bookmarklet
    Nipple clamps to ankles are always fun. That suction cup on her clit looks interesting

    Nipple clamps to ankles are always fun. That suction cup on her clit looks interesting

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornolabialoungekousokufuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr