Posts tagged "schoolgirl"
  1. Notes: 341 / 3 days ago  from bndgelvr (originally from notinagoodmood)
    That’s why I like those skirts, they quickly flip up and then she’s ready for anything.

    That’s why I like those skirts, they quickly flip up and then she’s ready for anything.

    (Source: notinagoodmood)

     
  2. Notes: 151 / 1 week ago  from masterspanker (originally from cperotica-deactivated20120130)
    Yum!

    Yum!

     
  3. Notes: 7 / 2 weeks ago  from bookmarklet
    That’s one nasty schoolgirl!

    That’s one nasty schoolgirl!

     
  4. Notes: 163 / 2 weeks ago  from bookmarklet
    Cute or not, you are still going to get spanked for wearing panties

    Cute or not, you are still going to get spanked for wearing panties

     
  5. Notes: 6 / 3 weeks ago  from bookmarklet
    Only a bit runny makeup. Either he didn’t go balls deep or his prick’s too short

    Only a bit runny makeup. Either he didn’t go balls deep or his prick’s too short

     
  6. Notes: 6 / 3 weeks ago  from bookmarklet
     
  7. Notes: 7 / 1 month ago  from bookmarklet
    Playing schoolgirl with her boyfriend

    Playing schoolgirl with her boyfriend

     
  8. Notes: 3 / 1 month ago  from bookmarklet
     
  9. Notes: 3 / 1 month ago  from bookmarklet
     
  10. 1 month ago 

    4 minutes of caning action.

avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornolabialoungekousokufuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr