Posts tagged "secretary"
  1. Notes: 102 / 2 days ago  from bndgelvr (originally from kanehoward)
    Seems cheap enough

    Seems cheap enough

    (Source: kanehoward)

     
  2. Notes: 97 / 3 days ago  from bndgelvr (originally from scentofslave)

    (Source: scentofslave)

     
  3. 1 week ago  from bookmarklet
     
  4. 1 week ago 
    Not what she expected when she was hired to answer the phone lordeestevao: “Ih… Acho que esqueci de ativar o viva-voz…” (via secretarialstudies) (via lordeestevao)

    Not what she expected when she was hired to answer the phone

    lordeestevao:

    “Ih… Acho que esqueci de ativar o viva-voz…”

    (via secretarialstudies)

    (via lordeestevao)

     
  5. 1 week ago 
    “Yes sir, tied up just like you asked sir” lordeestevao: “Chefe, a nova estagiária está pronta.” (via secretarialstudies) (via lordeestevao)

    “Yes sir, tied up just like you asked sir”

    lordeestevao:

    “Chefe, a nova estagiária está pronta.”

    (via secretarialstudies)

    (via lordeestevao)

     
  6. Notes: 8 / 2 weeks ago  from bookmarklet
    Do you recognize her? Neither did I but apparently Bobbi Star also does vanilla shoots between her BDSM work

    Do you recognize her? Neither did I but apparently Bobbi Star also does vanilla shoots between her BDSM work

     
  7. Notes: 16 / 2 weeks ago  from bookmarklet
    Well trained anal secretary

    Well trained anal secretary

     
  8. Notes: 5 / 3 weeks ago  from natashanylons
    natashanylons: Would you like to take me from behind boss

    natashanylons:

    Would you like to take me from behind boss

     
  9. Notes: 128 / 3 weeks ago  from workaholicatrest (originally from glamourbound)
    workaholicatrest: Finding a good secretary who’s willing to go the extra mile is getting more difficult everyday!

    workaholicatrest:

    Finding a good secretary who’s willing to go the extra mile is getting more difficult everyday!

    (Source: glamourbound)

     
  10. Notes: 2 / 3 weeks ago  from bookmarklet
    Still in training that he needs that crop?

    Still in training that he needs that crop?

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokufuckyeahstockingslabialoungedailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr