Posts tagged "spanking"
  1. Notes: 151 / 1 week ago  from masterspanker (originally from cperotica-deactivated20120130)
    Yum!

    Yum!

     
  2. Notes: 13 / 1 month ago  from bookmarklet
    Yes, 20 more and in front of the window where everyone can see!

    Yes, 20 more and in front of the window where everyone can see!

     
  3. Notes: 3 / 1 month ago  from bookmarklet
     
  4. Notes: 21 / 2 months ago  from orgasmgivr (originally from morethanithurtsme)
    That’s a seriously pounded ass!

    That’s a seriously pounded ass!

    (Source: morethanithurtsme)

     
  5. Notes: 12 / 3 months ago  from thetamingoftheslut (originally from spankingtushnthegiblets)
    Ah, some old fashioned office discipline

    Ah, some old fashioned office discipline

    (Source: spankingtushnthegiblets)

     
  6. 4 months ago  from bookmarklet
    Ashley makes a wonderful secretary, especially over the knee!

    Ashley makes a wonderful secretary, especially over the knee!

     
  7. Notes: 25 / 4 months ago  from dirtybadgirl

    (Source: dirtybadgirl)

     
  8. Notes: 3 / 4 months ago  from bookmarklet
     
  9. Notes: 553 / 5 months ago  from akinkygent (originally from spankingtushnthegiblets)
    Nice! fuckmylittlecunt: oww <3

    Nice!

    fuckmylittlecunt:

    oww <3

    (Source: spankingtushnthegiblets)

     
  10. Notes: 1 / 5 months ago  from bookmarklet
    I guess she spilled a few drops

    I guess she spilled a few drops

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornolabialoungekousokufuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr