Posts tagged "stockings"
  1. 2 days ago  from bookmarklet
     
  2. Notes: 68 / 3 days ago  from bndgelvr (originally from girlsinrubber)
    Love the outfit girlsinrubber: Dannii Harwood kinky bondage babe in the dungeon

    Love the outfit

    girlsinrubber:

    Dannii Harwood kinky bondage babe in the dungeon

     
  3. Notes: 79 / 1 week ago  from everydaycollars (originally from beautifulfetish)
    A corset and a harness, that’s going to be tight beautifulfetish: More of Laurie Wallace.  Click the image for the photoset

    A corset and a harness, that’s going to be tight

    beautifulfetish:

    More of Laurie Wallace.  Click the image for the photoset

     
  4. Notes: 163 / 2 weeks ago  from bookmarklet
    Cute or not, you are still going to get spanked for wearing panties

    Cute or not, you are still going to get spanked for wearing panties

     
  5. Notes: 67 / 3 weeks ago  from bookmarklet
    Sure does you good to get out in the fresh air

    Sure does you good to get out in the fresh air

     
  6. 3 weeks ago  from bookmarklet
     
  7. Notes: 112 / 4 weeks ago  from chilx (originally from bondagelover)

    (Source: bondagelover)

     
  8. Notes: 4 / 4 weeks ago  from bookmarklet
    Smile!

    Smile!

     
  9. Notes: 2 / 1 month ago  from bookmarklet
    Heels, stockings, gloves and a corset, always a good combination.

    Heels, stockings, gloves and a corset, always a good combination.

     
  10. Notes: 24 / 1 month ago  from bookmarklet
     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterfuckyeahstockingslabialoungekousokudailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr