Posts tagged "uniform"
  1. Notes: 22 / 6 days ago  from girlsinclothes
    The first one to get her ass whipped.

    The first one to get her ass whipped.

    (Source: girlsinclothes)

     
  2. Notes: 39 / 6 days ago  from bookmarklet
    Very interesting device.

    Very interesting device.

     
  3. Notes: 13 / 6 days ago  from workaholicatrest
    French maid on the job training? workaholicatrest: Two Chicks 1 Dick

    French maid on the job training?

    workaholicatrest:

    Two Chicks 1 Dick

     
  4. Notes: 38 / 1 week ago  from summertime75
    summertime75: Ancilla Tilia – Maid

    summertime75:

    Ancilla Tilia – Maid

     
  5. Notes: 10 / 1 week ago  from workaholicatrest (originally from elliecamille-deactivated2011121)
    I like’m too! workaholicatrest: My favorite fetish: French Maids!

    I like’m too!

    workaholicatrest:

    My favorite fetish: French Maids!

     
  6. Notes: 151 / 1 week ago  from masterspanker (originally from cperotica-deactivated20120130)
    Yum!

    Yum!

     
  7. 1 week ago 
    Not doing much work if you tie her to the chair lordeestevao: (via secretarialstudies) Pausa para o descanso. (via lordeestevao)

    Not doing much work if you tie her to the chair

    lordeestevao:

    (via secretarialstudies)

    Pausa para o descanso.

    (via lordeestevao)

     
  8. Notes: 3 / 3 weeks ago  from bookmarklet
    Staff sergeant gives her private some extra training

    Staff sergeant gives her private some extra training

     
  9. 3 weeks ago  from bookmarklet
    Private parts preparing for inspection

    Private parts preparing for inspection

     
  10. Notes: 3296 / 4 weeks ago  from fetish4 (originally from 55896)
    Even back in the 70s they liked a sexy stewardess.

    Even back in the 70s they liked a sexy stewardess.

    (Source: 55896)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornofuckyeahstockingslabialoungekousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr